Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUB2 Peptide - middle region

OTUB2 Peptide - middle region

Product Specifications

Product Name Alternative

C14orf137, FLJ21916, MGC3102, OTB2, OTU2

UniProt

Q96DC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUB2 Rabbit Polyclonal Antibody (orb331030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075601

Preservative

Lyophilized powder

AA Sequence

EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DO3A-Thiol TFA Salt
TRC-D499520-1MG 1 mg

DO3A-Thiol TFA Salt

Sign In for Pricing
View Details
Zfp219 (ZNF219) Rabbit Polyclonal Antibody
TA362283 100 µL

Zfp219 (ZNF219) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc13a4 Mouse Gene Knockout Kit (CRISPR)
KN515873 1 Kit

Slc13a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Phenethyl-2-pyridone
TRC-P321315-50MG 50 mg

1-Phenethyl-2-pyridone

Sign In for Pricing
View Details
Ethyl 6-Hydroxyhexanoate
TRC-E918970-5G 5 g

Ethyl 6-Hydroxyhexanoate

Sign In for Pricing
View Details
JunB (Ab-79) Antibody
8B7136-AAT 50 µg

JunB (Ab-79) Antibody

Sign In for Pricing
View Details