Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD6A Peptide - middle region

OTUD6A Peptide - middle region

Product Specifications

Product Name Alternative

DUBA2, FLJ25831, HSHIN6

UniProt

Q7L8S5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUD6A Rabbit Polyclonal Antibody (orb331027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997203

Preservative

Lyophilized powder

AA Sequence

KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit
MBS2708239-01 24 Strip Well

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit
MBS2708239-02 48 Well

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit
MBS2708239-03 96 Well

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit
MBS2708239-04 5x 96 Well

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit
MBS2708239-05 10x 96 Well

Mouse Interleukin 9 (IL9) Mini Samples ELISA Kit

Sign In for Pricing
View Details
FKBP7 (NM_181342) Human Over-expression Lysate
LS051661-20ug 20 µg

FKBP7 (NM_181342) Human Over-expression Lysate

Sign In for Pricing
View Details