Ovca2 Peptide - middle region
Ovca2 Peptide - middle region
Product Specifications
Product Name Alternative
RGD1564623
UniProt
D4A970
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ovca2 Rabbit Polyclonal Antibody (orb581203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001102506
Preservative
Lyophilized powder
AA Sequence
LDKLGPFDGLLGFSQGAALAAFVCALGQAGDPRFPLPRFIILVSGFCPRG
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9338997-01 48 Well
Mouse Solute carrier family 28 member 3, SLC28A3 ELISA Kit
Sign In for Pricing
View Details MBS9338997-02 96 Well
Mouse Solute carrier family 28 member 3, SLC28A3 ELISA Kit
Sign In for Pricing
View Details MBS9338997-03 5x 96 Well
Mouse Solute carrier family 28 member 3, SLC28A3 ELISA Kit
Sign In for Pricing
View Details 
MBS9338997-04 10x 96 Well
Mouse Solute carrier family 28 member 3, SLC28A3 ELISA Kit
Sign In for Pricing
View Details 
A136738 100 µL
Anti-TNFa/TNF-alpha (DLX105) Biosimilar (Monoclonal, IgG)
Sign In for Pricing
View Details