Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ovca2 Peptide - middle region

Ovca2 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1564623

UniProt

D4A970

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ovca2 Rabbit Polyclonal Antibody (orb581203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102506

Preservative

Lyophilized powder

AA Sequence

LDKLGPFDGLLGFSQGAALAAFVCALGQAGDPRFPLPRFIILVSGFCPRG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CAMKK2 Antibody Picoband®, HRP Conjugate
PA1497-HRP 100 µg

Anti-CAMKK2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
DTYMK Antibody
OAAN01759-200UL 200 µL

DTYMK Antibody

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 13 (FGF13)
RPU41436-01 50 µg

Recombinant Human Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 13 (FGF13)
RPU41436-02 100 µg

Recombinant Human Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 13 (FGF13)
RPU41436-03 1 mg

Recombinant Human Fibroblast Growth Factor 13 (FGF13)

Sign In for Pricing
View Details
NOXA2/p67phox Rabbit mAb
MBS9470729-01 0.05 mL

NOXA2/p67phox Rabbit mAb

Sign In for Pricing
View Details