Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVGP1 Peptide - C-terminal region

OVGP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHIT5, EGP, MUC9, OGP

UniProt

Q12889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OVGP1 Rabbit Polyclonal Antibody (orb584611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002548

Preservative

Lyophilized powder

AA Sequence

QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Customized v Antibody
orb807938 2 mg

Customized v Antibody

Sign In for Pricing
View Details
Human GDF9 knockdown cell line
ABC-KD5988 1 Vial

Human GDF9 knockdown cell line

Sign In for Pricing
View Details
Anti-Rabbit IgG (H+L), Human Serum Adsorbed - 80nm Gold Conjugate
AC-80-17-15 1 mL

Anti-Rabbit IgG (H+L), Human Serum Adsorbed - 80nm Gold Conjugate

Sign In for Pricing
View Details
TNF, CT (TNF, TNFA, TNFSF2, Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, Tumor necrosis factor, membrane form, N-terminal fragment, Intracellular domain 1, Intracellular domain 2, C-domain 1, C-domain 2, Tumor necrosis factor, soluble form) (Biotin) discontinued
043063-Biotin 200 µL

TNF, CT (TNF, TNFA, TNFSF2, Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, Tumor necrosis factor, membrane form, N-terminal fragment, Intracellular domain 1, Intracellular domain 2, C-domain 1, C-domain 2, Tumor necrosis factor, soluble form) (Biotin) discontinued

Sign In for Pricing
View Details
BIBO3304
MBS5776527 Inquire

BIBO3304

Sign In for Pricing
View Details
MRPS6 CytoSection
TS404000P5 25 Slides

MRPS6 CytoSection

Sign In for Pricing
View Details