Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXT Peptide - N-terminal region

OXT Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126890, MGC126892, OT, OT-NPI

UniProt

P01178

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OXT Rabbit Polyclonal Antibody (orb330205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000906

Preservative

Lyophilized powder

AA Sequence

LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Annexin A10 (ANXA10) ELISA Kit
MBS7234928-01 48 Well

Goat Annexin A10 (ANXA10) ELISA Kit

Sign In for Pricing
View Details
Goat Annexin A10 (ANXA10) ELISA Kit
MBS7234928-02 96 Well

Goat Annexin A10 (ANXA10) ELISA Kit

Sign In for Pricing
View Details
Goat Annexin A10 (ANXA10) ELISA Kit
MBS7234928-03 5x 96 Well

Goat Annexin A10 (ANXA10) ELISA Kit

Sign In for Pricing
View Details
Goat Annexin A10 (ANXA10) ELISA Kit
MBS7234928-04 10x 96 Well

Goat Annexin A10 (ANXA10) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bovine PRA1 family protein 2 (PRAF2)
orb2919653-01 20 µg

Recombinant Bovine PRA1 family protein 2 (PRAF2)

Sign In for Pricing
View Details
Recombinant Bovine PRA1 family protein 2 (PRAF2)
orb2919653-02 100 µg

Recombinant Bovine PRA1 family protein 2 (PRAF2)

Sign In for Pricing
View Details