Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXT Peptide - N-terminal region

OXT Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126890, MGC126892, OT, OT-NPI

UniProt

P01178

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OXT Rabbit Polyclonal Antibody (orb330205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000906

Preservative

Lyophilized powder

AA Sequence

LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat VDR (Vitamin D Receptor) ELISA Kit
EK243830 96 Well

Rat VDR (Vitamin D Receptor) ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli Maltose transport system permease protein malG (malG)
orb2910589-01 20 µg

Recombinant Escherichia coli Maltose transport system permease protein malG (malG)

Sign In for Pricing
View Details
Recombinant Escherichia coli Maltose transport system permease protein malG (malG)
orb2910589-02 100 µg

Recombinant Escherichia coli Maltose transport system permease protein malG (malG)

Sign In for Pricing
View Details
ETFB, Recombinant, Human, aa1-255, His-Tag (Electron Transfer Flavoprotein Subunit beta, Beta-ETF, FP585)
E8445-45C 250 µg

ETFB, Recombinant, Human, aa1-255, His-Tag (Electron Transfer Flavoprotein Subunit beta, Beta-ETF, FP585)

Sign In for Pricing
View Details
Gm13305 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21818124 3x 1.0µg DNA

Gm13305 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Ptpn11 (NM_001109992) Mouse Untagged Clone
MC219394 10 µg

Ptpn11 (NM_001109992) Mouse Untagged Clone

Sign In for Pricing
View Details