Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2rx2 Peptide - middle region

P2rx2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC129148, MGC129149, P2X2a, P2x2

UniProt

Q812E7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2rx2 Rabbit Polyclonal Antibody (orb575488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158306

Preservative

Lyophilized powder

AA Sequence

EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Rat Alkaline Phosphatase (ALP) ELISA
KLR0345 1x 96 Well

GENLISA™ Rat Alkaline Phosphatase (ALP) ELISA

Sign In for Pricing
View Details
Mouse Zfp600 (NM_001177546) AAV Particle
MR210286A1V 250 µL

Mouse Zfp600 (NM_001177546) AAV Particle

Sign In for Pricing
View Details
Phospho-Glycogen synthase 1 (Ser641) Rabbit pAb, BF700 conjugated
orb2841123 100 µL

Phospho-Glycogen synthase 1 (Ser641) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit
MBS9938355-01 48 Well

Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit

Sign In for Pricing
View Details
Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit
MBS9938355-02 96 Well

Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit

Sign In for Pricing
View Details
Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit
MBS9938355-03 5x 96 Well

Sheep Ectonucleoside Triphosphate Diphosphohydrolase 5 (ENTPD5) ELISA Kit

Sign In for Pricing
View Details