Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2rx2 Peptide - middle region

P2rx2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC129148, MGC129149, P2X2a, P2x2

UniProt

Q812E7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2rx2 Rabbit Polyclonal Antibody (orb575488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158306

Preservative

Lyophilized powder

AA Sequence

EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GRP94/HSP90B1 Antibody, Rabbit Polyclonal
MBS8100537-01 0.1 mL

Anti-GRP94/HSP90B1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-GRP94/HSP90B1 Antibody, Rabbit Polyclonal
MBS8100537-02 5x 0.1 mL

Anti-GRP94/HSP90B1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Human Mammaglobin-B, SCGB2A1 ELISA Kit
MBS945304-01 24 Well (LIMIT 1)

Human Mammaglobin-B, SCGB2A1 ELISA Kit

Sign In for Pricing
View Details
Human Mammaglobin-B, SCGB2A1 ELISA Kit
MBS945304-02 48 Well

Human Mammaglobin-B, SCGB2A1 ELISA Kit

Sign In for Pricing
View Details
Human Mammaglobin-B, SCGB2A1 ELISA Kit
MBS945304-03 96 Well

Human Mammaglobin-B, SCGB2A1 ELISA Kit

Sign In for Pricing
View Details
Human Mammaglobin-B, SCGB2A1 ELISA Kit
MBS945304-04 5x 96 Well

Human Mammaglobin-B, SCGB2A1 ELISA Kit

Sign In for Pricing
View Details