Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Peptide - C-terminal region

P2RY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

UniProt

P41231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_788085

Preservative

Lyophilized powder

AA Sequence

KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc20 (CDC20/1102), 1mg/mL
BNUM1102-50 1x 50 µL

Cdc20 (CDC20/1102), 1mg/mL

Sign In for Pricing
View Details
PPIH (NM_006347) Human Recombinant Protein
TP720226 10 µg

PPIH (NM_006347) Human Recombinant Protein

Sign In for Pricing
View Details
FKBP1B Rabbit Polyclonal Antibody
TA362224 100 µL

FKBP1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS627627 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
ZNF436 (NM_001077195) Human Over-expression Lysate
LY421377 100 µg

ZNF436 (NM_001077195) Human Over-expression Lysate

Sign In for Pricing
View Details
NAPG (Center) Rabbit Polyclonal Antibody
AP52808PU-N 400 µL

NAPG (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details