Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Peptide - C-terminal region

P2RY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

UniProt

P41231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_788085

Preservative

Lyophilized powder

AA Sequence

KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PPIB Antibody
RC-5172-01 50 μL

Recombinant PPIB Antibody

Sign In for Pricing
View Details
Recombinant PPIB Antibody
RC-5172-02 100 µL

Recombinant PPIB Antibody

Sign In for Pricing
View Details
Recombinant PPIB Antibody
RC-5172-03 1 mL

Recombinant PPIB Antibody

Sign In for Pricing
View Details
Recombinant C1QBP Antibody
RC-4916-01 50 μL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details
Recombinant C1QBP Antibody
RC-4916-02 100 µL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details
Recombinant C1QBP Antibody
RC-4916-03 1 mL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details