Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Peptide - C-terminal region

P2RY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

UniProt

P41231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_788085

Preservative

Lyophilized powder

AA Sequence

VRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXA (NM_000520) Human Over-expression Lysate
LC400176 20 µg

HEXA (NM_000520) Human Over-expression Lysate

Sign In for Pricing
View Details
PGA3 (C-term) Rabbit Polyclonal Antibody
AP53267PU-N 400 µL

PGA3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL
BNC402906-100 1x 100 µL

CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDX4 (NM_001136034) Human Recombinant Protein
TP326957M 100 µg

DDX4 (NM_001136034) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561190 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
IL33 Antibody
KC-2335-01 50 μL

IL33 Antibody

Sign In for Pricing
View Details