Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Peptide - C-terminal region

P2RY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

UniProt

P41231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_788085

Preservative

Lyophilized powder

AA Sequence

VRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCET2 (GCSAM) Human Gene Knockout Kit (CRISPR)
KN415443 1 Kit

GCET2 (GCSAM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2729-01 50 μL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2729-02 100 µL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2729-03 1 mL

ELAVL4 Antibody

Sign In for Pricing
View Details
Human CD52 activation kit by CRISPRa
GA100751 1 Kit

Human CD52 activation kit by CRISPRa

Sign In for Pricing
View Details
LRIG1 antibody
FNab09953 100 µg

LRIG1 antibody

Sign In for Pricing
View Details