Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA1 Peptide - middle region

P4HA1 Peptide - middle region

Product Specifications

Product Name Alternative

P4HA

UniProt

P13674

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P4HA1 Rabbit Polyclonal Antibody (orb331162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000908

Preservative

Lyophilized powder

AA Sequence

TKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Deoxy-2,2-difluoro-D-erythro-ribofuranose-3,5-dibenzoate (3,5-Di-O-benzoyl-2,2-difluoro-2-deoxyribose)
D3187-29 100 mg

2-Deoxy-2,2-difluoro-D-erythro-ribofuranose-3,5-dibenzoate (3,5-Di-O-benzoyl-2,2-difluoro-2-deoxyribose)

Sign In for Pricing
View Details
Troponin I, Cardiac
553674 1 mg

Troponin I, Cardiac

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (ACPP) (NM_001099) Human Recombinant Protein
TP720354 10 µg

Prostatic Acid Phosphatase (ACPP) (NM_001099) Human Recombinant Protein

Sign In for Pricing
View Details
PAK2 Rabbit mAb
AB102773 100 µL

PAK2 Rabbit mAb

Sign In for Pricing
View Details
Rat Pentosidine) ELISA Kit
QY-E11022 96 Tests

Rat Pentosidine) ELISA Kit

Sign In for Pricing
View Details
TAS2R5 (NM_018980) Human Tagged ORF Clone Lentiviral Particle
RC220188L3V 200 µL

TAS2R5 (NM_018980) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details