Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA1 Peptide - middle region

P4HA1 Peptide - middle region

Product Specifications

Product Name Alternative

P4HA

UniProt

P13674

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P4HA1 Rabbit Polyclonal Antibody (orb331162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000908

Preservative

Lyophilized powder

AA Sequence

TKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AUH (B-8) : m-IgGκ BP-HRP Bundle
sc-551269 1 Kit

AUH (B-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
GGCT Protein Lysate (Rat) with C-HA Tag
21468036 100 µg

GGCT Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
NSFL1C Adenovirus (Rat)
32194056 1.0 mL

NSFL1C Adenovirus (Rat)

Sign In for Pricing
View Details
Recombinant Human BCMA
MBS7610314-01 0.05 mg

Recombinant Human BCMA

Sign In for Pricing
View Details
Recombinant Human BCMA
MBS7610314-02 0.2 mg

Recombinant Human BCMA

Sign In for Pricing
View Details
Recombinant Human BCMA
MBS7610314-03 1 mg

Recombinant Human BCMA

Sign In for Pricing
View Details