Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA1 Peptide - middle region

P4HA1 Peptide - middle region

Product Specifications

Product Name Alternative

P4HA

UniProt

C9JL12

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P4HA1 Rabbit Polyclonal Antibody (orb331163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136068

Preservative

Lyophilized powder

AA Sequence

MAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3-pan (Acetyl Lys51/49) Polyclonal Antibody
UB-GEN-3300 100 µL

14-3-3-pan (Acetyl Lys51/49) Polyclonal Antibody

Sign In for Pricing
View Details
BIRC7 polyclonal antibody
orb649064-01 50 μL

BIRC7 polyclonal antibody

Sign In for Pricing
View Details
BIRC7 polyclonal antibody
orb649064-02 100 µL

BIRC7 polyclonal antibody

Sign In for Pricing
View Details
BIRC7 polyclonal antibody
orb649064-03 200 µL

BIRC7 polyclonal antibody

Sign In for Pricing
View Details
Anti-Integrin Beta 5 (ITGB5)
FY-AB49484-01 1 mL

Anti-Integrin Beta 5 (ITGB5)

Sign In for Pricing
View Details
Anti-Integrin Beta 5 (ITGB5)
FY-AB49484-02 100 µL

Anti-Integrin Beta 5 (ITGB5)

Sign In for Pricing
View Details