Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA2 Peptide - C-terminal region

P4HA2 Peptide - C-terminal region

Product Specifications

UniProt

O15460

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P4HA2 Rabbit Polyclonal Antibody (orb585255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017973

Preservative

Lyophilized powder

AA Sequence

VYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Deoxy-6-thio-heptakis(6-deoxy-6-(2-carboxyethyl)thio)-gamma-cyclodextrin
TRC-S809630-5MG 5 mg

6-Deoxy-6-thio-heptakis(6-deoxy-6-(2-carboxyethyl)thio)-gamma-cyclodextrin

Sign In for Pricing
View Details
RPLP2 (N-term) Rabbit Polyclonal Antibody
AP53727PU-N 400 µL

RPLP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRR20E Human Gene Knockout Kit (CRISPR)
KN425269 1 Kit

PRR20E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BANF1 (NM_003860) Human Over-expression Lysate
LC401269 20 µg

BANF1 (NM_003860) Human Over-expression Lysate

Sign In for Pricing
View Details
Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]
AM09370PU-N 100 µL

Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]

Sign In for Pricing
View Details
Mouse Gabpb1 activation kit by CRISPRa
GA201512 1 Kit

Mouse Gabpb1 activation kit by CRISPRa

Sign In for Pricing
View Details