P4HA2 Peptide - C-terminal region
P4HA2 Peptide - C-terminal region
Product Specifications
UniProt
O15460
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with P4HA2 Rabbit Polyclonal Antibody (orb585255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001017973
Preservative
Lyophilized powder
AA Sequence
VYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![HMB45 Mouse Monoclonal Antibody [Clone ID: HMB45]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc5d2/imageurl/am10112su-n.webp)
BNC681335-500 1x 500 µL
Helicobacter pylori (HP/1335), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY420556 100 µg
hnRNP F (HNRNPF) (NM_001098208) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC403655 20 µg
p107 (RBL1) (NM_183404) Human Over-expression Lysate
Sign In for Pricing
View Details