Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pa2g4 Peptide - C-terminal region

Pa2g4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

38kDa, AA672939, Ebp1, Plfap

UniProt

P50580

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pa2g4 Rabbit Polyclonal Antibody (orb583757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035249

Preservative

Lyophilized powder

AA Sequence

PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAGLB (Center) Rabbit Polyclonal Antibody
AP51182PU-N 400 µL

DAGLB (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Diacid
TRC-B390600-1MG 1 mg

Biotin Diacid

Sign In for Pricing
View Details
D-Tagatose
TRC-T004850-1G 1 g

D-Tagatose

Sign In for Pricing
View Details
Rabbit Interleukin 4 (IL4) ELISA Kit
RDR-IL4-Rb-01 96 Tests

Rabbit Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 4 (IL4) ELISA Kit
RDR-IL4-Rb-02 48 Tests

Rabbit Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI8B3]
CF811754 100 µg

RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI8B3]

Sign In for Pricing
View Details