Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pa2g4 Peptide - C-terminal region

Pa2g4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

38kDa, AA672939, Ebp1, Plfap

UniProt

P50580

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pa2g4 Rabbit Polyclonal Antibody (orb583757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035249

Preservative

Lyophilized powder

AA Sequence

PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cooled Incubator BICL-6004
BICL-6004 1 Unit

Cooled Incubator BICL-6004

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS637716 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
Prr14 Mouse Gene Knockout Kit (CRISPR)
KN513990 1 Kit

Prr14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc25a19 Antibody
KC-29812-01 50 μL

Slc25a19 Antibody

Sign In for Pricing
View Details
Slc25a19 Antibody
KC-29812-02 100 µL

Slc25a19 Antibody

Sign In for Pricing
View Details
Slc25a19 Antibody
KC-29812-03 1 mL

Slc25a19 Antibody

Sign In for Pricing
View Details