Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAF1 Peptide - N-terminal region

PAF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

F23149_1, FLJ11123, PD2

UniProt

Q8N7H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAF1 Rabbit Polyclonal Antibody (orb585035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061961

Preservative

Lyophilized powder

AA Sequence

IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BRD469) [Alexa Fluor 405]
NBP2-34565AF405 0.1 mL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BRD469) [Alexa Fluor 405]

Sign In for Pricing
View Details
Cynomolgus Monkey Testis Total RNA
NHP-RA034 Each

Cynomolgus Monkey Testis Total RNA

Sign In for Pricing
View Details
Recombinant Sorghum bicolor Photosystem II reaction center protein T (psbT), partial
MBS1118302-01 1 mg (E-Coli)

Recombinant Sorghum bicolor Photosystem II reaction center protein T (psbT), partial

Sign In for Pricing
View Details
Recombinant Sorghum bicolor Photosystem II reaction center protein T (psbT), partial
MBS1118302-02 1 mg (Yeast)

Recombinant Sorghum bicolor Photosystem II reaction center protein T (psbT), partial

Sign In for Pricing
View Details
Lysine Decarboxylase Broth w/o Peptone
DM 1376I-01 100 g

Lysine Decarboxylase Broth w/o Peptone

Sign In for Pricing
View Details
Lysine Decarboxylase Broth w/o Peptone
DM 1376I-02 500 g

Lysine Decarboxylase Broth w/o Peptone

Sign In for Pricing
View Details