Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAF1 Peptide - N-terminal region

PAF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

F23149_1, FLJ11123, PD2

UniProt

Q8N7H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAF1 Rabbit Polyclonal Antibody (orb585035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061961

Preservative

Lyophilized powder

AA Sequence

IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1 Human shRNA Plasmid Kit (Locus ID 3290)
TL304036 1 Kit

HSD11B1 Human shRNA Plasmid Kit (Locus ID 3290)

Sign In for Pricing
View Details
MRX40 Protein Vector (Human) (pPM-C-HA)
30659021 500 ng

MRX40 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SFT2D3 Protein Vector (Human) (pPM-C-His)
PV037796 500 ng

SFT2D3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CCR-1 Antibody
251538 0.1 mg

CCR-1 Antibody

Sign In for Pricing
View Details
ESR2 Chemi-Luminescent ELISA Kit (Human)
OKCD03437-96W 96 Well

ESR2 Chemi-Luminescent ELISA Kit (Human)

Sign In for Pricing
View Details
SCARB1 (N-Term) Rabbit pAb
MBS8553540-01 0.1 mL

SCARB1 (N-Term) Rabbit pAb

Sign In for Pricing
View Details