Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAGE4 Peptide - middle region

PAGE4 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ35184, GAGE-9, GAGEC1, JM27, PAGE-1, PAGE-4, JM-27, CT16.7

UniProt

O60829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAGE4 Rabbit Polyclonal Antibody (orb578434) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008934

Preservative

Lyophilized powder

AA Sequence

PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-01 5 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-02 10 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-03 20 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-04 50 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-05 100 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IMPA3 Protein, Mouse, Recombinant (His)
TMPJ-01200-06 200 µg

IMPA3 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details