PAIP2 Peptide - N-terminal region
PAIP2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC72018, PAIP2A
UniProt
Q9BPZ3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAIP2 Rabbit Polyclonal Antibody (orb583074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057564
Preservative
Lyophilized powder
AA Sequence
MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401058-500 1x 500 µL
Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470956-100 1x 100 µL
UACA / Nucling (AE-5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471985-500 1x 500 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details