Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAIP2 Peptide - N-terminal region

PAIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC72018, PAIP2A

UniProt

Q9BPZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAIP2 Rabbit Polyclonal Antibody (orb583074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057564

Preservative

Lyophilized powder

AA Sequence

MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBR4 Polyclonal Antibody
E-AB-53573-01 20 µL

UBR4 Polyclonal Antibody

Sign In for Pricing
View Details
UBR4 Polyclonal Antibody
E-AB-53573-02 60 µL

UBR4 Polyclonal Antibody

Sign In for Pricing
View Details
UBR4 Polyclonal Antibody
E-AB-53573-03 120 µL

UBR4 Polyclonal Antibody

Sign In for Pricing
View Details
UBR4 Polyclonal Antibody
E-AB-53573-04 200 µL

UBR4 Polyclonal Antibody

Sign In for Pricing
View Details
ELAPOR2 (NM_001142749) Human Over-expression Lysate
LC428259 20 µg

ELAPOR2 (NM_001142749) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), Biotin conjugate, 0.1mg/mL
BNCB0860-500 1x 500 µL

Human Lambda Light Chain (Lamb14), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details