Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pak4 Peptide - N-terminal region

Pak4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Pak4

UniProt

B5DF62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pak4 Rabbit Polyclonal Antibody (orb580429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099708

Preservative

Lyophilized powder

AA Sequence

TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD319/SLAMF7 Antibody , FITC
E55A07778 50 Tests

Human CD319/SLAMF7 Antibody , FITC

Sign In for Pricing
View Details
Rabbit Monoclonal BPIFB1 Antibody (LPLUNC1/7059R) [HRP]
NBP3-14065H 0.1 mL

Rabbit Monoclonal BPIFB1 Antibody (LPLUNC1/7059R) [HRP]

Sign In for Pricing
View Details
Copper (II) Sulphate Pentahydrate 98.5% Extrapure
00872 00500 500 g

Copper (II) Sulphate Pentahydrate 98.5% Extrapure

Sign In for Pricing
View Details
NUDT4 (NM_019094) Human Recombinant Protein
PROTQ9NZJ9 20 µg

NUDT4 (NM_019094) Human Recombinant Protein

Sign In for Pricing
View Details
USP43 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49327064 1.0 µg DNA

USP43 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Hu CD279 Purified
11-176-C100 0.1 mg

Anti-Hu CD279 Purified

Sign In for Pricing
View Details