Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pak4 Peptide - N-terminal region

Pak4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Pak4

UniProt

B5DF62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pak4 Rabbit Polyclonal Antibody (orb580429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099708

Preservative

Lyophilized powder

AA Sequence

TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1533 sgRNA CRISPR Lentivector set (Rat)
K7293601 3x 1.0 µg

Olr1533 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RBM12 (NM_152838) Human Tagged ORF Clone
RG203639 10 µg

RBM12 (NM_152838) Human Tagged ORF Clone

Sign In for Pricing
View Details
Organo / Limonene Mount
AR-6504-06 2500 mL

Organo / Limonene Mount

Sign In for Pricing
View Details
ZNF329 Antibody
A16102-100UG 100 µg

ZNF329 Antibody

Sign In for Pricing
View Details
Anti-Human TCL1 antibody
STJ16100429 1 mL

Anti-Human TCL1 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Integrin alpha E/CD103 Antibody [Alexa Fluor 532]
NBP2-98926AF532 0.1 mL

Rabbit Polyclonal Integrin alpha E/CD103 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details