Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALM Peptide - N-terminal region

PALM Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0270

UniProt

O75781

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PALM Rabbit Polyclonal Antibody (orb326088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035224

Preservative

Lyophilized powder

AA Sequence

LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtap7d1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4710002 1.0 µg DNA

Mtap7d1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Ap4b1 (NM_001163553) Mouse Tagged ORF Clone
MG216183 10 µg

Ap4b1 (NM_001163553) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Folin & Wu'S Alkaline Copper Solution
1242F 00500 500 mL

Folin & Wu'S Alkaline Copper Solution

Sign In for Pricing
View Details
Cecropin-A Mouse Monoclonal Antibody (PerCP-Cy5.5)
orb2370476 100 µL

Cecropin-A Mouse Monoclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal RCOR1/CoREST Antibody [Janelia Fluor 549]
NB600-240JF549 0.1 mL

Rabbit Polyclonal RCOR1/CoREST Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Eukaryotic Interleukin 7 Receptor (IL7R), Recombinant, Human, His-Tag
051294-01 10 µg

Eukaryotic Interleukin 7 Receptor (IL7R), Recombinant, Human, His-Tag

Sign In for Pricing
View Details