Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TENT2 Peptide - C-terminal region

TENT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Papd4

UniProt

Q5U315

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TENT2 Rabbit Polyclonal Antibody (orb580649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008373

Preservative

Lyophilized powder

AA Sequence

YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL
BNC882066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDAP1 (NM_014891) Human Recombinant Protein
TP720268 10 µg

PDAP1 (NM_014891) Human Recombinant Protein

Sign In for Pricing
View Details
Psg23 Mouse Gene Knockout Kit (CRISPR)
KN514081 1 Kit

Psg23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FECH (NM_001012515) Human Over-expression Lysate
LC422881 20 µg

FECH (NM_001012515) Human Over-expression Lysate

Sign In for Pricing
View Details
NFkB Inducing Kinase NIK (MAP3K14) (NM_003954) Human Over-expression Lysate
LC401299 20 µg

NFkB Inducing Kinase NIK (MAP3K14) (NM_003954) Human Over-expression Lysate

Sign In for Pricing
View Details
2',7'-Difluorofluorescein
TRC-D447020-50MG 50 mg

2',7'-Difluorofluorescein

Sign In for Pricing
View Details