Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TENT2 Peptide - C-terminal region

TENT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Papd4

UniProt

Q5U315

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TENT2 Rabbit Polyclonal Antibody (orb580649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008373

Preservative

Lyophilized powder

AA Sequence

YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KTEL1 (POGLUT1) Rabbit Polyclonal Antibody
TA380117 100 µL

KTEL1 (POGLUT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF647 conjugate, 0.1mg/mL
BNC470868-500 1x 500 µL

Golgi Complex (AE-6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mal-amido-peg6-NHS
TRC-M111053-50MG 50 mg

Mal-amido-peg6-NHS

Sign In for Pricing
View Details
CD71 (DF1513), CF647 conjugate, 0.1mg/mL
BNC470188-500 1x 500 µL

CD71 (DF1513), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Map4k1 Mouse Gene Knockout Kit (CRISPR)
KN309744 1 Kit

Map4k1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd5l Mouse Gene Knockout Kit (CRISPR)
KN502930 1 Kit

Cd5l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details