Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARD6A Peptide - N-terminal region

PARD6A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAR-6A, PAR6, PAR6C, PAR6alpha, TAX40, TIP-40

UniProt

Q3TY70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARD6A Rabbit Polyclonal Antibody (orb578633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032358

Preservative

Lyophilized powder

AA Sequence

MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itaconic acid
280592-01 25 g

Itaconic acid

Sign In for Pricing
View Details
Itaconic acid
280592-02 50 g

Itaconic acid

Sign In for Pricing
View Details
Itaconic acid
280592-03 100 g

Itaconic acid

Sign In for Pricing
View Details
Itaconic acid
280592-04 250 g

Itaconic acid

Sign In for Pricing
View Details
Itaconic acid
280592-05 500 g

Itaconic acid

Sign In for Pricing
View Details
OR4K17 Adenovirus (Human)
35237051 1.0 mL

OR4K17 Adenovirus (Human)

Sign In for Pricing
View Details