Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP8 Peptide - C-terminal region

PARP8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21308, MGC42864, pART16

UniProt

Q8N3A8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP8 Rabbit Polyclonal Antibody (orb574819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078891

Preservative

Lyophilized powder

AA Sequence

AKDEPASSSKSSNTSQSQKKGQQSQFLQSRNLKCIALCEVITSSDLHKHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV621038 1.0 µg DNA

CDT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Prl3d1 Protein Vector (Mouse) (pPB-C-His)
PV219410 500 ng

Prl3d1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Boc-Glu (OBzl) -OH 10mM * 1mL in DMSO
A23701-10mM-D 10 mM x 1mL in DMSO

Boc-Glu (OBzl) -OH 10mM * 1mL in DMSO

Sign In for Pricing
View Details
DLX2 (NM_004405) Human Over-expression Lysate
LC418012 20 µg

DLX2 (NM_004405) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Nin Pre-designed siRNA Set A
SI209308A 1 Each

Rat Nin Pre-designed siRNA Set A

Sign In for Pricing
View Details
EAPII Antibody (C-term)
MBS9207540-01 0.08 mL

EAPII Antibody (C-term)

Sign In for Pricing
View Details