Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP8 Peptide - C-terminal region

PARP8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21308, MGC42864, pART16

UniProt

Q8N3A8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP8 Rabbit Polyclonal Antibody (orb574819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078891

Preservative

Lyophilized powder

AA Sequence

AKDEPASSSKSSNTSQSQKKGQQSQFLQSRNLKCIALCEVITSSDLHKHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Oncogene (MaxLight 550) discontinued
171711-ML550 100 µL

P53 Oncogene (MaxLight 550) discontinued

Sign In for Pricing
View Details
HLA-DQA1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
23433062 1.0 µg DNA

HLA-DQA1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-TNFSF14 / LIGHT / CD258 (SAR252067)
C00806-1mg*5 5x 1mg

Anti-TNFSF14 / LIGHT / CD258 (SAR252067)

Sign In for Pricing
View Details
PCMF (KCMF1) (NM_020122) Human Tagged Lenti ORF Clone
RC201679L2 10 µg

PCMF (KCMF1) (NM_020122) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CLDN9 antibody - C-terminal region (ARP33617_T100)
ARP33617_T100 100 µL

CLDN9 antibody - C-terminal region (ARP33617_T100)

Sign In for Pricing
View Details
SULT1B1 (Sulfotransferase Family Cytosolic 1B Member 1, Sulfotransferase 1B1, ST1B1, Sulfotransferase 1B2, ST1B2, SULT1B2, Thyroid Hormone Sulfotransferase)
134078 200 µL

SULT1B1 (Sulfotransferase Family Cytosolic 1B Member 1, Sulfotransferase 1B1, ST1B1, Sulfotransferase 1B2, ST1B2, SULT1B2, Thyroid Hormone Sulfotransferase)

Sign In for Pricing
View Details