Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Peptide - N-terminal region

Parp8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810430O08Rik, D13Ertd275e

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Parp8 Rabbit Polyclonal Antibody (orb578630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074478

Preservative

Lyophilized powder

AA Sequence

ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-HA-HSPA1A(C603A) Plasmid
PVTB00012-2j 2 µg

pCMV-HA-HSPA1A(C603A) Plasmid

Sign In for Pricing
View Details
GLIPR2 Human siRNA Oligo Duplex (Locus ID 152007)
SR315800 1 Kit

GLIPR2 Human siRNA Oligo Duplex (Locus ID 152007)

Sign In for Pricing
View Details
Aldolase B (C-11) Alexa Fluor® 594
sc-393278 AF594 200 µg/mL

Aldolase B (C-11) Alexa Fluor® 594

Sign In for Pricing
View Details
NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (AP) discontinued
249469-AP 100 µL

NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (AP) discontinued

Sign In for Pricing
View Details
MIR3110 Mouse qPCR Primer Pair (MI0014107)
MP300637 200 Reactions

MIR3110 Mouse qPCR Primer Pair (MI0014107)

Sign In for Pricing
View Details
Raf-1 (phospho Ser259) Polyclonal Antibody
RA29212-01 50 µL

Raf-1 (phospho Ser259) Polyclonal Antibody

Sign In for Pricing
View Details