Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Peptide - N-terminal region

Parp8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810430O08Rik, D13Ertd275e

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Parp8 Rabbit Polyclonal Antibody (orb578630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074478

Preservative

Lyophilized powder

AA Sequence

ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Diamine Oxidase (DAO) ELISA Kit
EIA05560Gu 1 Kit

Guinea pig Diamine Oxidase (DAO) ELISA Kit

Sign In for Pricing
View Details
Recombinant Antibody to Interleukin 1 Beta (IL1b)
TRV-0053925-01 20 µL

Recombinant Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Antibody to Interleukin 1 Beta (IL1b)
TRV-0053925-02 100 µL

Recombinant Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Antibody to Interleukin 1 Beta (IL1b)
TRV-0053925-03 200 µL

Recombinant Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Antibody to Interleukin 1 Beta (IL1b)
TRV-0053925-04 1 mL

Recombinant Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HNRPC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV811128 1.0 µg DNA

HNRPC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details