Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Peptide - C-terminal region

Parp8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810430O08Rik, D13Ertd275e

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Parp8 Rabbit Polyclonal Antibody (orb578631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_983188

Preservative

Lyophilized powder

AA Sequence

LIGILTPSSSSSQPPVRKHFHLAFLHVAKGQEICLHFLIRPGRGKKQDTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magnesium Sulfate
TRC-M198130-5G 5 g

Magnesium Sulfate

Sign In for Pricing
View Details
Myorg Mouse Gene Knockout Kit (CRISPR)
KN501025 1 Kit

Myorg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NASP Rabbit Polyclonal Antibody
TA370633 100 µL

NASP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Neurogenin 2 Antibody
RC-16115-01 50 μL

Recombinant Neurogenin 2 Antibody

Sign In for Pricing
View Details
Recombinant Neurogenin 2 Antibody
RC-16115-02 100 µL

Recombinant Neurogenin 2 Antibody

Sign In for Pricing
View Details
Recombinant Neurogenin 2 Antibody
RC-16115-03 1 mL

Recombinant Neurogenin 2 Antibody

Sign In for Pricing
View Details