Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Peptide - C-terminal region

Parp8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810430O08Rik, D13Ertd275e

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Parp8 Rabbit Polyclonal Antibody (orb578631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_983188

Preservative

Lyophilized powder

AA Sequence

LIGILTPSSSSSQPPVRKHFHLAFLHVAKGQEICLHFLIRPGRGKKQDTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC68 (NM_001143829) Human Over-expression Lysate
LY428372 100 µg

CCDC68 (NM_001143829) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF640R conjugate, 0.1mg/mL
BNC402591-100 1x 100 µL

S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cd4 Rat Monoclonal Antibody [Clone ID: CT-CD4]
CL004B 100 µg

Cd4 Rat Monoclonal Antibody [Clone ID: CT-CD4]

Sign In for Pricing
View Details
Mouse Akr1b3 activation kit by CRISPRa
GA200163 1 Kit

Mouse Akr1b3 activation kit by CRISPRa

Sign In for Pricing
View Details
Skint4 Mouse Gene Knockout Kit (CRISPR)
KN515830 1 Kit

Skint4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SLITL2 (VASN) activation kit by CRISPRa
GA114502 1 Kit

Human SLITL2 (VASN) activation kit by CRISPRa

Sign In for Pricing
View Details