Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax2 Peptide - middle region

Pax2 Peptide - middle region

Product Specifications

Product Name Alternative

Pax-2, Opdc

UniProt

P32114

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pax2 Rabbit Polyclonal Antibody (orb573744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035167

Preservative

Lyophilized powder

AA Sequence

HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NeuN (RBFOX3) activation kit by CRISPRa
GA115573 1 Kit

Human NeuN (RBFOX3) activation kit by CRISPRa

Sign In for Pricing
View Details
WDSUB1 (NM_001128212) Human Over-expression Lysate
LY426926 100 µg

WDSUB1 (NM_001128212) Human Over-expression Lysate

Sign In for Pricing
View Details
TCF7L2 (NM_001146283) Human Over-expression Lysate
LC431432 20 µg

TCF7L2 (NM_001146283) Human Over-expression Lysate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), Biotin conjugate, 0.1mg/mL
BNCB1946-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATF2 Recombinant Rabbit Monoclonal Antibody [SZ17-01]
ET1603-15 100 µL

ATF2 Recombinant Rabbit Monoclonal Antibody [SZ17-01]

Sign In for Pricing
View Details
NEK6 (NM_001166170) Human Over-expression Lysate
LC431847 20 µg

NEK6 (NM_001166170) Human Over-expression Lysate

Sign In for Pricing
View Details