Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax2 Peptide - middle region

Pax2 Peptide - middle region

Product Specifications

Product Name Alternative

Pax-2, Opdc

UniProt

P32114

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pax2 Rabbit Polyclonal Antibody (orb573744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035167

Preservative

Lyophilized powder

AA Sequence

HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His-Avi) Biotinylated
PKSH033917-01 20 µg

Recombinant Human IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His-Avi) Biotinylated
PKSH033917-02 100 µg

Recombinant Human IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His-Avi) Biotinylated

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: OTI4C12]
CF806978 100 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: OTI4C12]

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (D33), 0.2mg/mL
BNUB1722-100 1x 100 µL

Desmin (Muscle Cell Marker) (D33), 0.2mg/mL

Sign In for Pricing
View Details
NOTCH1 Human Gene Knockout Kit (CRISPR)
KN211365LP 1 Kit

NOTCH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MARK4 Mouse Monoclonal Antibody [Clone ID: OTI9B7]
CF808507 100 µg

MARK4 Mouse Monoclonal Antibody [Clone ID: OTI9B7]

Sign In for Pricing
View Details