Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax8 Peptide - C-terminal region

Pax8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pax-8

UniProt

Q00288

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pax8 Rabbit Polyclonal Antibody (orb574974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035170

Preservative

Lyophilized powder

AA Sequence

PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eftozanermin alfa
HY-P99934-01 1 mg

Eftozanermin alfa

Sign In for Pricing
View Details
Eftozanermin alfa
HY-P99934-02 5 mg

Eftozanermin alfa

Sign In for Pricing
View Details
Eftozanermin alfa
HY-P99934-03 10 mg

Eftozanermin alfa

Sign In for Pricing
View Details
Klebsiella Antibody
GWB-D5E7F3 1 mL

Klebsiella Antibody

Sign In for Pricing
View Details
Low Sample Volume Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
abx513200-01 96 Tests

Low Sample Volume Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
abx513200-02 5x 96 Tests

Low Sample Volume Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details