Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBRM1 Peptide - N-terminal region

PBRM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BAF180, MGC156155, MGC156156, PB1

UniProt

Q86U86

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_851384

Preservative

Lyophilized powder

AA Sequence

PSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD69 Rabbit Monoclonal Antibody
MA1798-.1 100 µL

Anti-CD69 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
9230110F15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3226706 1.0 µg DNA

9230110F15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Surangin B
MBS5801554 Inquire

Surangin B

Sign In for Pricing
View Details
Tmem179b (NM_026325) Mouse Tagged ORF Clone
MR214337 10 µg

Tmem179b (NM_026325) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KDEL Receptor Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2495025 100 µL

KDEL Receptor Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Lentiviral mouse Rspo3 shRNA (UAS) - Lentiviral mouse Rspo3 shRNA (UAS, GFP) (100)
GTR15194493 1 Vial

Lentiviral mouse Rspo3 shRNA (UAS) - Lentiviral mouse Rspo3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details