Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pbx4 Peptide - N-terminal region

Pbx4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410015M21Rik, AI429113, AW045266

UniProt

Q99NE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pbx4 Rabbit Polyclonal Antibody (orb576299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020125

Preservative

Lyophilized powder

AA Sequence

MAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDEAQARKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD7 (NM_001114632) Human Over-expression Lysate
LY426498 100 µg

JMJD7 (NM_001114632) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS621124 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL
BNC400757-100 1x 100 µL

Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TUBB2B (NM_178012) Human Recombinant Protein
TP309075M 100 µg

TUBB2B (NM_178012) Human Recombinant Protein

Sign In for Pricing
View Details
NDUFB3 Human Gene Knockout Kit (CRISPR)
KN401988 1 Kit

NDUFB3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
25-Hydroxy Vitamin D2
TRC-H995820-1MG 1 mg

25-Hydroxy Vitamin D2

Sign In for Pricing
View Details