Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pbx4 Peptide - N-terminal region

Pbx4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410015M21Rik, AI429113, AW045266

UniProt

Q99NE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pbx4 Rabbit Polyclonal Antibody (orb576299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020125

Preservative

Lyophilized powder

AA Sequence

MAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDEAQARKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IDO1/IDO Protein (His Tag)
PKSM041057-01 10 µg

Recombinant Mouse IDO1/IDO Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IDO1/IDO Protein (His Tag)
PKSM041057-02 50 µg

Recombinant Mouse IDO1/IDO Protein (His Tag)

Sign In for Pricing
View Details
CD55 (NM_000574) Human Over-expression Lysate
LY424635 100 µg

CD55 (NM_000574) Human Over-expression Lysate

Sign In for Pricing
View Details
HOGA1 Antibody
KC-43184-01 50 μL

HOGA1 Antibody

Sign In for Pricing
View Details
HOGA1 Antibody
KC-43184-02 100 µL

HOGA1 Antibody

Sign In for Pricing
View Details
HOGA1 Antibody
KC-43184-03 1 mL

HOGA1 Antibody

Sign In for Pricing
View Details