Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PC Peptide - C-terminal region

PC Peptide - C-terminal region

Product Specifications

Product Name Alternative

PCB

UniProt

P11498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PC Rabbit Polyclonal Antibody (orb584393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035806

Preservative

Lyophilized powder

AA Sequence

SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc36a1 3'UTR Luciferase Stable Cell Line
TU220631 1.0 mL

Slc36a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse UBR1 ELISA Kit
E051485 1 Each

Mouse UBR1 ELISA Kit

Sign In for Pricing
View Details
SNX9 Rabbit pAb
MBS8544152-01 0.1 mL

SNX9 Rabbit pAb

Sign In for Pricing
View Details
SNX9 Rabbit pAb
MBS8544152-02 0.1 mL (AF405L)

SNX9 Rabbit pAb

Sign In for Pricing
View Details
SNX9 Rabbit pAb
MBS8544152-03 0.1 mL (AF405S)

SNX9 Rabbit pAb

Sign In for Pricing
View Details
SNX9 Rabbit pAb
MBS8544152-04 0.1 mL (AF610)

SNX9 Rabbit pAb

Sign In for Pricing
View Details