PC Peptide - C-terminal region
PC Peptide - C-terminal region
Product Specifications
Product Name Alternative
PCB
UniProt
P11498
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PC Rabbit Polyclonal Antibody (orb584393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035806
Preservative
Lyophilized powder
AA Sequence
SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![7-Bromo-12- (2-naphthalenyl) benz[a]anthracene](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
MBS6302094-01 0.2 mL
GGH, NT (GGH, Gamma-glutamyl hydrolase, Conjugase, GH, Gamma-Glu-X carboxypeptidase) (AP)
Sign In for Pricing
View Details MBS6302094-02 5x 0.2 mL
GGH, NT (GGH, Gamma-glutamyl hydrolase, Conjugase, GH, Gamma-Glu-X carboxypeptidase) (AP)
Sign In for Pricing
View Details 
K0005-08B-FITC 200 µL
Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (FITC) discontinued
Sign In for Pricing
View Details MBS1459858-01 0.02 mg (E-Coli)
Recombinant Corynebacterium diphtheriae Thymidylate synthase (thyA)
Sign In for Pricing
View Details