Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCBD2 Peptide - N-terminal region

PCBD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DCOH2, DCOHM, PHS2

UniProt

Q9H0N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCBD2 Rabbit Polyclonal Antibody (orb584698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115527

Preservative

Lyophilized powder

AA Sequence

SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Legumain (m) -PR
sc-60931-PR 10 µM - 20 µL

Legumain (m) -PR

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS616240 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
Human MYO (Myoglobin) ELISA Kit
EK250627 96 Well

Human MYO (Myoglobin) ELISA Kit

Sign In for Pricing
View Details
MTSS1 (NM_001282974) Human Tagged ORF Clone
RG239432 10 µg

MTSS1 (NM_001282974) Human Tagged ORF Clone

Sign In for Pricing
View Details
PCB 1x Element Congener PCB-183 Neat - 5MG
REPCB1067N 5 mg

PCB 1x Element Congener PCB-183 Neat - 5MG

Sign In for Pricing
View Details
Anti-Nuclear antibody ELISA
EIA D1014-AB01 96 Well

Anti-Nuclear antibody ELISA

Sign In for Pricing
View Details