Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCBD2 Peptide - N-terminal region

PCBD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DCOH2, DCOHM, PHS2

UniProt

Q9H0N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCBD2 Rabbit Polyclonal Antibody (orb584698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115527

Preservative

Lyophilized powder

AA Sequence

SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIG4 Antibody
orb1731150 100 µL

FIG4 Antibody

Sign In for Pricing
View Details
Canine Apoptosis Inducing Factor (AIF) ELISA Kit
EIA05230Ca 1 Kit

Canine Apoptosis Inducing Factor (AIF) ELISA Kit

Sign In for Pricing
View Details
Anti-PIK3AP1 Antibody Picoband®, APC Conjugate
A08114-APC 100 µg/Vial

Anti-PIK3AP1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Rabbit Polyclonal HPS4 Antibody
NBP2-31898 0.1 mL

Rabbit Polyclonal HPS4 Antibody

Sign In for Pricing
View Details
Phospho-Smad3 (S425) Antibody Blocking Peptide
orb1505183 500 µg

Phospho-Smad3 (S425) Antibody Blocking Peptide

Sign In for Pricing
View Details
LAMP1 discontinued
401720-01 50 µL

LAMP1 discontinued

Sign In for Pricing
View Details