Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcdh11x Peptide - middle region

Pcdh11x Peptide - middle region

Product Specifications

Product Name Alternative

A230092L07Rik, MGC141524, PCDHX, PCDHX11

UniProt

E9Q622

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pcdh11x Rabbit Polyclonal Antibody (orb579941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074854

Preservative

Lyophilized powder

AA Sequence

LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexaglycerin
TRC-H366750-5G 5 g

Hexaglycerin

Sign In for Pricing
View Details
CDK1 Recombinant Rabbit Monoclonal Antibody [SM01-44]
ET1605-54 100 µL

CDK1 Recombinant Rabbit Monoclonal Antibody [SM01-44]

Sign In for Pricing
View Details
Mouse Cradd activation kit by CRISPRa
GA200864 1 Kit

Mouse Cradd activation kit by CRISPRa

Sign In for Pricing
View Details
L-alpha-Aminoxy-beta-phenylpropionic Acid Hydrobromide
TRC-A632500-25MG 25 mg

L-alpha-Aminoxy-beta-phenylpropionic Acid Hydrobromide

Sign In for Pricing
View Details
Human ZNF723 activation kit by CRISPRa
GA118790 1 Kit

Human ZNF723 activation kit by CRISPRa

Sign In for Pricing
View Details
Nitrovin Hydrochloride
TRC-N494710-25MG 25 mg

Nitrovin Hydrochloride

Sign In for Pricing
View Details