Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHA11 Peptide - N-terminal region

PCDHA11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11

UniProt

Q9Y5I1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHA11 Rabbit Polyclonal Antibody (orb580704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114067

Preservative

Lyophilized powder

AA Sequence

RLSKNEYFSLDSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCFC1 Rabbit Polyclonal Antibody (Fluoro550)
orb3112948 100 µg

HCFC1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit
ELK7037-01 48 Tests

Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit
ELK7037-02 96 Tests

Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit
ELK7037-03 5x 96 Tests

Rat HIF2a (Hypoxia Inducible Factor 2 Alpha) ELISA Kit

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody [Clone:2G6]
E45M13514 100 µg

SAPK4 (MAPK13) Mouse Monoclonal Antibody [Clone:2G6]

Sign In for Pricing
View Details
Rabbit Activin AB ELISA Kit
MBS098839 Inquire

Rabbit Activin AB ELISA Kit

Sign In for Pricing
View Details