PCGF1 Peptide - middle region
PCGF1 Peptide - middle region
Product Specifications
Product Name Alternative
2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68
UniProt
Q9BSM1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCGF1 Rabbit Polyclonal Antibody (orb578806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116062
Preservative
Lyophilized powder
AA Sequence
PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Podoplanin Antibody (LF3 B7 D5B3) [Alexa Fluor 488]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NB110-96423AF488 0.1 mL
Mouse Monoclonal Podoplanin Antibody (LF3 B7 D5B3) [Alexa Fluor 488]
Sign In for Pricing
View Details QAD46230-01 50 mg
6-Cyclopropyl-3-oxo-2,3-dihydropyridazine-4-carboxylic acid
Sign In for Pricing
View Details 
QAD46230-02 0.5 g
6-Cyclopropyl-3-oxo-2,3-dihydropyridazine-4-carboxylic acid
Sign In for Pricing
View Details GTR15368399 1 Vial
Lentiviral human SSB sgRNA gene knockout kit - Lentiviral human SSB sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details